PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.5G268900.1.p
Common NameSETIT_004703mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family NAC
Protein Properties Length: 323aa    MW: 34812.4 Da    PI: 4.9687
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.5G268900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM66.76.8e-21211516128
                 NAM   6 rFhPtdeelvveyLkkkvegkklele.evikevdiykvePwdLpk.....kvkaeekewyfFskrdkkyatgkrknr..atksgyWkatgk 88 
                         + hP++e+l+   L++++++   +    +i+++d+y+++P +L +      +++++  wyfFs  + k++ g+rk r   t +g W++   
  Seita.5G268900.1.p  21 ETHPSEEQLIASLLRPRAAAPGDDGPcAFIHDADVYSADPAELTAefapaVASNGDGAWYFFSAVRAKTRDGQRKARtvDTGEGCWHSEAG 111
                         669**************998885553056**************84467754455777********************5447799******* PP

                 NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          k+v+++ g+  g ++++ f ++ + + +++ W+m e +l
  Seita.5G268900.1.p 112 AKPVVDEAGRYLGHRQSFSFVTKVDGRRVRSGWLMVELSL 151
                         *********************99999999******99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.15E-3211172IPR003441NAC domain
PROSITE profilePS5100532.34416172IPR003441NAC domain
PfamPF023652.7E-1117150IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MVVATRRMTA PRPLPPPPDL ETHPSEEQLI ASLLRPRAAA PGDDGPCAFI HDADVYSADP  60
AELTAEFAPA VASNGDGAWY FFSAVRAKTR DGQRKARTVD TGEGCWHSEA GAKPVVDEAG  120
RYLGHRQSFS FVTKVDGRRV RSGWLMVELS LDDGGGGGGA ATDMVLCKIY FSPRARVNGG  180
APAASSSSSL AGRKRKAGAA AGNNKNPAPA ARQQRRRRAR PTEAGAQSHD EDTDDDKGEE  240
STTQGGEVAA ESSAAGEEEE ELWTDGSSFS WWMKNRDRIM KEYNIVDRSD EELLETLGLT  300
EYMKALTSFD YGDDMDPRLR KA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-121717016166Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002458311.11e-102hypothetical protein SORBIDRAFT_03g031000
TrEMBLK3XS060.0K3XS06_SETIT; Uncharacterized protein
STRINGSi004703m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40112972
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.14e-15NAC domain containing protein 35